PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc02582.1.g00080.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family CO-like
Protein Properties Length: 289aa    MW: 30323.6 Da    PI: 5.2058
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc02582.1.g00080.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box24.36.6e-081962441
                      zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg.......Htvvp 41
                                  r C+ +  ++++l+C+ ++++lC+ C    H g       H++ p
  Zmw_sc02582.1.g00080.1.sm.mk 19 RHCDACAAEPARLHCRADGSYLCPGCDARAH-GaxxxxrrHERLP 62
                                  78*****************************.5578888898776 PP

2CCT70.64e-24210252143
                           CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkq 43 
                                   Rea+l+RY+eKrk+R+F+K+irY+sRKa+Ae+RpR+KGrF+k+
  Zmw_sc02582.1.g00080.1.sm.mk 210 REARLMRYREKRKNRRFDKTIRYASRKAYAETRPRIKGRFAKR 252
                                   9****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011910.8791663IPR000315B-box-type zinc finger
SMARTSM003368.9E-51663IPR000315B-box-type zinc finger
PfamPF006435.2E-61963IPR000315B-box-type zinc finger
CDDcd000211.59E-61963No hitNo description
PfamPF062032.4E-18210252IPR010402CCT domain
PROSITE profilePS5101716.916210252IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 289 aa     Download sequence    Send to blast
MDAAAEQKPA LGYWGLGARH CDACAAEPAR LHCRADGSYL CPGCDARAHG AXXXXRRHER  60
LPVAPFFGAI ADAPQPFPSP AFAAAAAGVQ ETAADDDGSN EAEAASWLLP EPDNSHGDSA  120
DADAFFADSD AYLGVDIDFA RSVDGIKAIG VPVAPPEMDL TGSGGFFYPE HSVNHSVSSS  180
EVAVVPDALA TACASAAPSL PAVASRGKER EARLMRYREK RKNRRFDKTI RYASRKAYAE  240
TRPRIKGRFA KRCSAEAEAE DAAAAAACCS PAVSVPSASD GDYGVVPSF
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004953058.11e-122PREDICTED: zinc finger protein CONSTANS-LIKE 3-like
TrEMBLC5XXA81e-122C5XXA8_SORBI; Putative uncharacterized protein Sb04g025660
STRINGSb04g025660.11e-121(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP21913272